ValueError: min() arg is an empty sequence

[xy127]

Hello,
I used python version of 3.11.4 to create a conda environment and pip install igfold. I successfully finished all the example codes without issue. But when I replace with my own sequence, the following error occurs:

  File "/home/ubuntu/user_space/predictantibody.py", line 10, in <module>
    igfold.fold(
  File "/home/ubuntu/user_space/miniconda3/envs/igfold/lib/python3.11/site-packages/igfold/IgFoldRunner.py", line 106, in fold
    model_out = fold(
                ^^^^^
  File "/home/ubuntu/user_space/miniconda3/envs/igfold/lib/python3.11/site-packages/igfold/utils/folding.py", line 221, in fold
    process_prediction(
  File "/home/ubuntu/user_space/miniconda3/envs/igfold/lib/python3.11/site-packages/igfold/utils/folding.py", line 139, in process_prediction
    renumber_pdb(
  File "/home/ubuntu/user_space/miniconda3/envs/igfold/lib/python3.11/site-packages/igfold/utils/abnumber_.py", line 63, in renumber_pdb
    assert len(chain_res) == len(numbering)
           ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^
AssertionError

sequences = {
    "H": "EVQLVESGGGLVQPGGSLRLSCAASDFSLTTYGVHWVRQAPGKGLEWLGVIWSGGSTDYNAAFISRLTISKDNSKNTVYLQMNSLRAEDTAVYYCARDYGSTYVDAIDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYGSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK",
    "L": "DIVLTQSPDSLAVSLGERATINCRASESVESYGNRYMTWYQQKPGQPPKLLIYRAANLQSGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQSNEDPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC"
}

[jeffreyruffolo]

Hello, it looks like your sequences contain many extra residues beyond the variable domain (Fv). IgFold isn’t trained to predict this much of the structure, but if you truncate to just the variable domain it should work.