Corrupt structures
lhatsk opened this issue · 2 comments
Hi,
I am currently testing IgFold on newer targets from SAbDab, for example, 7ox1 A/B following the instructions in: https://github.com/Graylab/IgFold#antibody-structure-prediction-from-sequence using IgFold 0.4 (also tested 0.3.1).
For most of the targets, I end up with broken predictions, ie, no secondary structures and big clashes (see attachment). The example on GitHub works. Any idea what's going wrong?
Thanks!
sequences = {'H': 'QLQLVESGPGLVKPSQTLSLTCTVSGGSITTGYYAWSWIRQPPGKGLEWMGFIARDGSTSYSPSLKSRTSISRDTSKNQFSLQLSSVTPEDTAVYYCARAGEGRSWYPGYYYGMDYWGKGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC', 'L': 'QAVVTQEPSLSVSPGGTVTLTCGLSSGSVTSSNYPGWYQQTPGQAPRVLIYNTNSRHSGVPSRYSGFISGNKAALTITGAEPEDEADYYCHLHKGSTGVFGGGTHLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS'}
I just noticed that the problem is caused by using the full heavy / light chain from the PDB.
Hi, yes that's correct. IgFold expects to receive just the Fv portions of the heavy and light chains.