/sequence-viewer

neXtProt protein sequence viewer (javascript) - From SIB CALIPHO group; neXtProt project

Primary LanguageJavaScript

neXtProt - The knowledge resource on human proteins

This is a code repository for the SIB - Swiss Institute of Bioinformatics CALIPHO group neXtProt project

See: http://www.nextprot.org/

neXtProt sequence viewer

Build Status

The sequence viewer is a super easy javascript library to use in order to draw a protein sequence in a readable way.

Sequence viewer1

Live demo: https://cdn.rawgit.com/calipho-sib/sequence-viewer/master/examples/index.html

Simple example: https://cdn.rawgit.com/calipho-sib/sequence-viewer/master/examples/simple.html

Getting Started

  1. Include the library using bower or npm or simply by including the javascript sequence-viewer.js
//BOWER//
bower install sequence-viewer

//NODE//
npm install sequence-viewer
  1. Specify a div in your html
<div id="sequence-viewer"></div>
  1. Create an instance of Sequence in javascript and apply the render method
//For Node add before : var Sequence = require("sequence-viewer"); //


var seq = new Sequence('MALWMRLLPLLALLALWGPGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN');
// Render the sequence with or without rendering options
// (Check the interactive documentation)
seq.render('#sequence-viewer');
  1. Et voila!

Sequence viewer2

Note: if you choose the later approach with only the main javascript you should also include the dependencies, jquery,handlebars and bootstrap.min.css

Documentation

Check out this interactive page for a better understanding of how to use the sequence viewer and its possibilities :

Options

  • Show chars per line
  • Wrap lines
  • Highlight
  • Coverage
  • Labels
  • Toolbar (chars per line)
  • Search
  • Title
  • sequenceMaxHeight
  • Events
  • Badge

Examples

https://search.nextprot.org/entry/NX_P01308/structures

Support

If you have any problem or suggestion please open an issue here.

Development

git clone https://github.com/calipho-sib/sequence-viewer.git

npm install (will install the development dependencies)

bower install (will install the browser dependencies)

...make your changes and modifications...

npm run dist (will create the min & bundle versions in dist/)

npm run build (will create the bundle js & css in build/ for node)

grunt bump (will push and add a new release)

npm publish (will publish in npm)

License

This software is licensed under the GNU GPL v2 license, quoted below.

Copyright (c) 2015, SIB Swiss Institute of Bioinformatics